HiActi™ Recombinant Mouse IL-27 EBI3 Protein, His Tag _ 90292ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

The predicted molecular weight of Interleukin-27 EBI3 (IL-27 EBI3) is 23.4 kDa. IL-27 is a heterodimeric cytokine composed of Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. It is expressed by antigen-presenting cells and interacts with a specific cell surface receptor complex known as the IL-27 receptor (IL-27R). Specifications Cat.No. 90292ES08 / 90292ES20 / 90292ES60 / 90292ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 90292ES08 90292ES20 90292ES60 90292ES76 HiActi™ Recombinant Mouse IL-27 EBI3 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms interleukin 27 EBI3, IL-27, Interleukin-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27 Species Mouse Expression Sequence MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus. Accession O35228 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 23.84 kDa. The protein migrates about 25 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more